Aktionstag am WvSG für die Schüler- und Schülerinnen der 4. Klassen, Freitag, 13.12.2019, ab 16:00 Uhr

Differenzierungsbereich Jahrgangsstufe 8/9

Naturwissenschaften

Halbjahresthemen

Klasse 8.1: Wasser
Im ersten Halbjahr der Klasse 8 stehen die Inhalte unter dem Oberthema Wasser auf dem Plan mit Beteiligung der Fächer Biologie, Chemie, Physik und Erdkunde.
(Bilder und Fotos einfügen)
Mögliche Themen sind z. B.:
• Bestimmung des Wassergehaltes von Tieren und Pflanzen
• Die Aufgaben des Wassers und seiner Inhaltsstoffe in Organismen
• Chemische und physikalische Eigenschaften von Wasser
• Trinkwasser: Ressourcen, Aufbereitung, Anforderungen
• Wasser als Lösungsmittel und Extraktionsmittel, Wasser in Getränken
• Brauchwasser: Kühlwasser, Waschwasser, Versalzung bei Bewässerung
• Abwasser: Inhaltsstoffe, Kläranlagen, Selbstreinigungskraft

In jedem Jahr gibt es noch eine Projektphase, entweder zu einem aktuellen Wettbewerb oder zu einem früheren Wettbewerbsthema aus dem Bereich Biologie/Chemie wie zum Beispiel das Thema „Biochemische Scheren“ (Enzyme). Hier arbeiten die Schülerinnen und Schüler in Gruppen über mehrere Wochen relativ eigenständig „forschend“.

Klasse 8.2: Haut und Kosmetik; Farbstoffe und Pigmente
Im zweite Halbjahr der Klasse 8 dreht sich alles um das Thema Haut und Kosmetik mit Beteiligung der Fächer Biologie, Chemie und Physik.
(Bilder und Fotos einfügen)

Mögliche Themen sind z. B.:
Haut und Kosmetik
• Aufbau der menschlichen Haut
• Biologische Funktion der Haut
• Altersveränderungen der Haut
• Hautkrankheiten
• Funktion der Kosmetika: Vorbeugen, Reinigen, Pflegen, Verschönern
• Verschiedene Arten von Kosmetika
• Herstellung ausgewählter Kosmetika
• Haare (Aufbau und Funktion; Mikroskopie)

Farbstoffe und Pigmente
• Das elektromagnetische Spektrum (Potenzen, Einheiten umrechnen)
• Wellencharakter des Lichts
• Die Zerlegung von Licht durch ein Prisma in Strahlung verschiedener Wellenlängen
• Additive und subtraktive Farbmischung
• Bau und Funktion des Auges
• Herstellung ausgesuchter Pigmente (nicht löslich)
• Struktur von Perlglanzpigmenten
• Inhaltsstoffe von Lacken (Pigmente, Bindemittel, Lösungsmittel)
• Farbstoffe (löslich), natürliche Farbstoffe
• Färbung von textilen Fasern

Klasse 9.1: Energie und Brennstoffe; Aerodynamik
In der Klasse 9 wechseln die Themen verstärkt in den Bereich Physik mit Beteiligung der Fächer Chemie und Geographie. Im ersten Halbjahr steht zunächst das Thema Energie und Brennstoffe auf dem Plan gefolgt vom Thema Aerodynamik.
(Bilder und Fotos einfügen)

Mögliche Themen sind z. B.:
Energie und Brennstoffe:
• Erdöl, Erdgas und Kohle als fossile Brennstoffe
• Entstehung von Lagerstätten
• Verarbeitung von Rohöl: Petrochemie
• Physikalische und chemische Eigenschaften von Benzin und Diesel
• Kernenergie
• Regenerative Energiequellen
• Schülerreferate inkl. PowerPoint und Handout

Aerodynamik:
• cW-Werte
• Fliegen, Flügelformen im Windkanal

Klasse 9.2: Elektronik
Das zweite Halbjahr beinhaltet das Oberthema Elektronik mit Beteiligung der Fächer Physik, Technik, Mathematik und Informatik.
Bilder und Fotos einfügen
Mögliche Themen sind z. B.:
• Kryptologie: Verschlüsselung, angefangen bei Cäsar über Vigenere bis hin zu Verschlüsselungstechniken in heutigen PCs
• Gefahren im E-Mail-Verkehr (Rollenspiele, z. B. Abfangen von E-Mails, Passwortdiebstahl)
• Logische Schaltungen, Digitaltechnik
• Halbleiter, Halbaddierer, Rechenwerke

Eine Besonderheit des Werner-von-Siemens-Gymnasiums ist sicherlich die Erweiterung des Faches Physik im zweiten Halbjahr der Klasse 7. Hier besteht die Möglichkeit an Themen im Bereich Technik zu arbeiten, für die im Rahmen des normalen Unterrichts keine Zeit ist. Im Vordergrund stehen dabei das Interesse und die individuelle Förderung unserer Schülerinnen und Schüler. Methodisch wird hauptsächlich in Form von Projekten bzw. mit Schülerexperimenten gearbeitet.
Mögliche Themen sind z. B.

- „Rückstoßprinzip - Bau einer Rakete“
- „Kreative Antriebsmöglichkeiten – Bau eines Wagens mit einer Mausefalle als ‚Motor oder Bau eines ‚Gummiband- Motor-Wagens‘“
- Einfache Maschinen, Pneumatik – Bau eines Baggers…….
- Zaubern mit Physik (Freihandexperimente)

„Zum Erstaunen bin ich da“ (J.W. von Goethe)

Physikalische Phänomene rufen immer wieder Überraschungen und Erstaunen hervor. Jeder von uns kennt nicht nur unzählige verblüffende Spielzeuge, die auf physikalischen Sachverhalten beruhen, sondern auch berühmte physikalische Formeln oder Theorien, die auf den ersten Blick unverständlich und doch faszinierend scheinen.
Der Physikunterricht am Werner-von-Siemens-Gymnasium hat sich genau diesen Satz von Johann Wolfgang von Goethe zur Aufgabe gemacht: Es gilt die Fähigkeit zum Staunen zu wecken und das Faszinierende an naturwissenschaftlichen Phänomenen zu entdecken und zu bewahren.

So gründet sich der Physikunterricht in den Klassen 6, 8 und 9 der Sekundarstufe I in großen Teilen auf Schülerexperimenten, die aus Fragestellungen der Alltagswirklichkeit erwachsen. Dabei planen die Schülerinnen und Schüler eigenständig Versuche, führen diese durch und werten sie anschließend aus. Dieses selbstständige Lernen befähigt die Schülerinnen und Schüler, naturwissenschaftliche Problemstellungen zu erkennen, aus Belegen Schlussfolgerungen zu ziehen und erlerntes Wissen anzuwenden.

Eine Besonderheit des Werner-von-Siemens-Gymnasiums sind sicherlich die Erweiterung des Faches Physik im zweiten Halbjahr der Klasse 7 („Physik in Klasse 7“) und im Wahlpflichtbereich die Möglichkeit, einen naturwissenschaftlichen Schwerpunkt durch die Wahl des Faches „Naturwissenschaften“ ( „Naturwissenschaften im Wahlpflichtbereich“) zu setzen.

Im Unterricht der Sekundarstufe II werden die Schülerinnen und Schüler in Grund- oder Leistungskursen auf das Zentralabitur vorbereitet. Hier steht neben der Entwicklung, Durchführung und Auswertung von Experimenten auch die Mathematisierung physikalischer Theorien im Vordergrund. Dazu gehört es ebenso, ein Problembewusstsein zu schaffen, um mit Hilfe des erlernten Wissens eine sachlich fundierte Beurteilung verschiedener Modelle und Theorien leisten zu können. Diese naturwissenschaftlich-physikalische Bildung trägt so auch dazu bei, sich kritisch mit einer modernen, technisierten und sich ständig verändernden Welt auseinandersetzen zu können.
Der Unterricht ist auch hier kontextgeleitet. Kontexte sind z. B. „Teilnahme am Straßenverkehr“, „Himmelsmechanik“, „Wandlung und Verwandlung elektrischer Energie“ und „Wie kann man Atome sehen?“.

Um einen vertieften Einblick in die Berufswelt von Physikern oder Ingenieuren und in alltägliche Anwendungsbereiche der Physik zu bekommen, wird großen Wert auf das außerschulische Lernen („Außerschulisches Lernen“) gelegt. So werden regelmäßig externe Experten eingeladen, wie z. B. das „Einsteinmobil – Einstein on Tour“ („Einstein-Mobil“), das mit interaktiven Lernmodulen zum Thema „Einsteins Relativitätstheorie“ zwei Wochen zu Besuch an unserer Schule war, und unseren Schülerinnen und Schülern von Klasse 6 bis Q2 einmalige Erfahrungen wie das Radfahren mit Lichtgeschwindigkeit, eine Flugsimulation über eine Fantasieinsel bei Lichtgeschwindigkeit sowie das Spiel mit einem schwarzen Loch ermöglichten. Des Weiteren finden regelmäßig Besichtigungen bei den Stadtwerken Gronau oder Exkursionen, beispielsweise ins Lichtlabor nach Arnsberg, statt.
Eine weitere Zusammenarbeit besteht mit der Universität Münster. Prof. Dr. Christine Thomas vom Fachbereich Geophysik kam extra aus Münster ans Werner-von-Siemens-Gymnasium angereist, um im Rahmen des Programms „Rent a prof“ einen äußerst spannenden Vortrag zum Thema „Warum bebt die Erde?“ zu halten. („Rent a prof“) Außerdem kooperiert unsere Schule mit den jeweiligen Fachbereichen der Didaktik des Physikunterrichts, um beispielsweise bei der Erforschung und Erprobung neuer Unterrichtsmethoden eine Hilfe zu bieten.

Der Physikunterricht am Werner-von-Siemens-Gymnasium versucht durch diese verschiedenen Aspekte auf vielfältige Weise nicht nur dem oben genannten Leitsatz treu zu bleiben, sondern auch dem Namensgeber der Schule als einem der bedeutensten Naturwissenschaftlern gerecht zu werden. „Es kommt nicht darauf an, mit dem Kopf durch die Wand zu gehen, sondern mit den Augen die Tür zu finden.“ – dieses Zitat Werner von Siemens´ macht dabei mehr als deutlich, dass die Fähigkeit, aufmerksam und forschend durch die Welt und das Leben zu gehen, in besonderer Weise dazu beiträgt, seine Ziele zu erreichen.

Den Schülerinnen und Schülern unserer Schule wünschen wir dabei neben all der Verwunderung und dem Erstaunen über die Physik einen Lernerfolg, den Albert Einstein mit folgenden Worten zur Sprache bringt:
„Das Erstaunlichste an der Welt ist, dass man sie verstehen kann.“